This is a working overview of enzymatic recycling, written for readers who want more than a one-paragraph summary but less than a textbook.
This page was last updated on 2025-12-23 and is reviewed periodically as new material appears.
Quality control for glutathione focuses on identity, purity, and oxidation state. Certificates of analysis may report assay value, water content, and the presence of GSSG or other impurities. Chromatographic purity is often expressed as a percentage of peak area. Reference standards help laboratories compare results across instruments and batches. Because glutathione is a small, polar molecule, separation from cysteine, gamma-glutamylcysteine, and related thiols can be challenging. Verification often combines more than one analytical technique.
Measuring glutathione requires attention to sample preparation because the molecule oxidizes readily. Blood, tissue, and cell samples are often treated with acid to precipitate proteins and stabilize the thiol. Without such steps, GSH can convert to GSSG or form mixed disulfides during storage. Analytical methods include spectrophotometric assays, high-performance liquid chromatography, and mass spectrometry. Each approach has different sensitivity, specificity, and susceptibility to interference from related compounds in complex matrices.
Storage conditions strongly influence glutathione stability. The solid reduced form is commonly kept desiccated at or below minus twenty degrees Celsius, protected from light and moisture. Aqueous solutions are less stable because the thiol group reacts with dissolved oxygen, and oxidation accelerates at neutral or alkaline pH. Acidic solutions and oxygen-free handling can slow degradation, but repeated freeze-thaw cycles should be avoided. Researchers often verify concentration before use, because apparent losses can arise from oxidation or water uptake.
Measuring glutathione in biological samples requires attention to oxidation and matrix effects. High-performance liquid chromatography with ultraviolet or fluorescence detection can separate reduced and oxidized forms after derivatization. Liquid chromatography with tandem mass spectrometry offers higher specificity and can quantify glutathione alongside related thiols. Because glutathione can oxidize during sample handling, many protocols use rapid acidification with metaphosphoric acid or sulfosalicylic acid. Internal standards help correct for losses during extraction and analysis.
Enzymatic recycling assays provide a complementary approach for total glutathione. In these methods, glutathione reductase reduces oxidized glutathione while a thiol-reactive reagent, such as 5,5'-dithiobis(2-nitrobenzoic acid), produces a colored product. The reaction cycles between reduced and oxidized forms, amplifying the signal. Spectrophotometric or fluorometric detection can then estimate concentration. Distinguishing reduced glutathione from glutathione disulfide often requires separate aliquots, masking agents, or chromatographic separation, and the choice affects reported values.
| Property | Value | Notes |
|---|---|---|
| Typical assay | HPLC-UV or LC-MS/MS | Derivatization may improve detection |
| Storage temperature | -20 °C or below | Keep desiccated and protected from light |
| Appearance | White to off-white crystalline powder | Reduced form |
| Solubility | Freely soluble in water | Insoluble in lipids and nonpolar solvents |
| Common synonyms | L-Glutathione; GSH | GSH denotes reduced form |
Commercial glutathione is available in research-grade, food-grade, and supplement-grade forms, and purity specifications differ accordingly. Certificates of analysis commonly report identity by nuclear magnetic resonance or mass spectrometry, purity by HPLC, residual solvents, and heavy metals. Reference standards with assigned purity support calibration, while isotopically labeled glutathione can serve as an internal standard for mass spectrometry. For supplements, label claims may not be independently verified, and regulatory oversight varies by country. Verification often involves third-party testing for identity, potency, and contaminants.
Quantifying glutathione requires distinguishing GSH from GSSG and preventing oxidation during sample preparation. Common approaches include the enzymatic recycling assay, often called the Tietze method, which measures total glutathione after converting GSSG to GSH. HPLC with ultraviolet or fluorescence detection and LC-MS/MS can separate and quantify both forms, sometimes after derivatization of the thiol group. Blood, plasma, and tissue samples differ in matrix and baseline concentrations, so method validation must account for recovery, linearity, and interference. No single assay is universally standard.
Glutathione is most stable as a dry powder stored cool and dry, but its thiol group is readily oxidized in solution. Aqueous preparations at neutral or alkaline pH lose GSH faster because the thiolate form reacts with dissolved oxygen and metal ions. Acidic conditions, chelating agents, and oxygen exclusion can slow oxidation, while repeated freeze-thaw cycles promote degradation. Light exposure and trace metals also contribute to loss. Laboratories typically validate stability for their own matrices because degradation rates depend on pH, temperature, concentration, and container materials.
Samples for glutathione analysis require careful handling because the compound oxidizes readily and can be consumed by enzymes after collection. Blood is often treated with acid or thiol-blocking agents soon after draw, and plasma should be separated quickly from red blood cells. Tissues are usually snap-frozen or extracted immediately. Aqueous solutions of glutathione are less stable than dry powder and degrade faster at neutral or alkaline pH, in light, or with dissolved oxygen. Repeated freeze-thaw cycles also reduce reliability.
Quality control for glutathione materials checks identity, assay, purity, water content, and disulfide content. Commercial products vary from research-grade powder to dietary supplements, and labels may not distinguish reduced from oxidized forms. In the United States, oral glutathione is commonly sold as a dietary supplement rather than an approved drug, while injectable forms fall under different rules and may require a prescription. Regulatory status differs by country. Analytical certificates, when available, help verify what a material contains, but independent testing remains important for interpretation.
Laboratory measurement of glutathione typically starts with rapid acid extraction to prevent oxidation and enzymatic degradation. Common methods include enzymatic recycling assays, high-performance liquid chromatography, and liquid chromatography coupled with mass spectrometry. The recycling assay uses glutathione reductase and a thiol-reactive colorimetric or fluorescent reagent, measuring total glutathione after converting disulfide forms. Chromatographic methods can separate reduced and oxidized forms, which helps when the redox ratio is the target. Choice of method affects sensitivity, specificity, and the amount of sample needed.
For solid glutathione reagents, storage at low temperature and protection from moisture and light are typical precautions. Aqueous solutions can oxidize over time, and pH affects stability; alkaline conditions generally promote thiol oxidation. Some protocols prepare fresh solutions, while others use antioxidants or chelators to limit metal-catalyzed oxidation. Purity and counterion content can vary among commercial preparations, affecting concentration calculations. Certificates of analysis and validated assays help verify identity and purity.
Measuring glutathione in biological samples requires attention to oxidation, because GSH can convert to GSSG after sample collection. Blood and plasma samples are often treated with acid or alkylating agents to preserve the reduced form. Without stabilization, apparent GSH concentrations can fall while GSSG rises. Differences in sample type, handling delay, and deproteinization method can produce results that are not comparable across studies. Reporting preanalytical details is therefore important for interpreting findings.
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.
Palestinian militancy has been the main focus of the IDF ever since, especially during the First and Second Intifadas, Operation Defensive Shield, the Gaza War, Operation Pillar of Defense, and Operation Protective Edge, causing the IDF to change many of its values and publish the IDF Spirit. The Lebanese Shia organization Hezbollah has also been a growing threat, against which the IDF fought an asymmetric conflict between 1982 and 2000, as well as a full-scale war in 2006.
=== Biocide === Acrolein is mainly used as a contact herbicide to control submersed and floating weeds, as well as algae, in irrigation canals. It is used at a level of 10 ppm in irrigation and recirculating waters. In the oil and gas industry, it is used as a biocide in drilling waters, as well as a scavenger for hydrogen sulfide and mercaptans.
== NFL career == The Washington Redskins signed him on August 15, 2015. This came on the back of Niles Paul and Logan Paulson being placed on the Injured Reserve list. He was waived on August 31, 2015.
First, the Citizens Rights Directive 2004 article 4 says every citizen has the right to depart a member state with a valid passport. This has historical importance for central and eastern Europe, when the Soviet Union and the Berlin Wall denied its citizens the freedom to leave. Article 5 gives every citizen a right of entry, subject to national border controls. Schengen Area countries (not the UK and Ireland) abolished the need to show documents, and police searches at borders, altogether. These reflect the general principle of free movement in TFEU article 21. Second, article 6 allows every citizen to stay three months in another member state, whether economically active or not. Article 7 allows stays over three months with evidence of "sufficient resources... not to become a burden on the social assistance system". Articles 16 and 17 give a right to permanent residence after 5 years without conditions. Third, TEU article 10(3) requires the right to vote in the local constituencies for the European Parliament wherever a citizen lives.
Sources: en.wikipedia.org
Female spotted hyenas exposed to larger doses of androgen have significantly damaged ovaries, making it difficult to conceive. After giving birth, the pseudo-penis is stretched and loses much of its original aspects; it becomes a slack-walled and reduced prepuce with an enlarged orifice with split lips. Approximately 15% of the females die during their first time giving birth, and over 60% of their species' firstborn young die. A 2006 Baskin et al. study concluded, "The basic anatomical structures of the corporeal bodies in both sexes of humans and spotted hyenas were similar. As in humans, the dorsal nerve distribution was unique in being devoid of nerves at the 12 o'clock position in the penis and clitoris of the spotted hyena" and that "[d]orsal nerves of the penis/clitoris in humans and male spotted hyenas tracked along both sides of the corporeal body to the corpus spongiosum at the 5 and 7 o'clock positions. The dorsal nerves penetrated the corporeal body and distally the glans in the hyena", and in female hyenas, "the dorsal nerves fanned out laterally on the clitoral body. Glans morphology was different in appearance in both sexes, being wide and blunt in the female and tapered in the male".
=== Redox === Polycyclic aromatic compounds characteristically yield radicals and anions upon treatment with alkali metals. The large PAH form dianions as well. The redox potential correlates with the size of the PAH.
The existence of anthropomorphic images and half-human, half-animal images in the Upper Paleolithic may further indicate that Upper Paleolithic humans were the first people to believe in a pantheon of gods or supernatural beings, though such images may instead indicate shamanistic practices similar to those of contemporary tribal societies. The earliest known undisputed burial of a shaman (and by extension the earliest undisputed evidence of shamans and shamanic practices) dates back to the early Upper Paleolithic era (c. 30,000 BP) in what is now the Czech Republic. However, during the early Upper Paleolithic it was probably more common for all members of the band to participate equally and fully in religious ceremonies, in contrast to the religious traditions of later periods when religious authorities and part-time ritual specialists such as shamans, priests and medicine men were relatively common and integral to religious life. Religion was possibly apotropaic; specifically, it may have involved sympathetic magic. The Venus figurines, which are abundant in the Upper Paleolithic archaeological record, provide an example of possible Paleolithic sympathetic magic, as they may have been used for ensuring success in hunting and to bring about fertility of the land and women. The Upper Paleolithic Venus figurines have sometimes been explained as depictions of an earth goddess similar to Gaia, or as representations of a goddess who is the ruler or mother of the animals.
Unresolved complex mixture (UCM), or hump, is a feature frequently observed in gas chromatographic (GC) data of crude oils and extracts from organisms exposed to oil. The reason for the UCM hump appearance is that GC cannot resolve and identify a significant part of the hydrocarbons in crude oils. The resolved components appear as peaks while the UCM appears as a large background/platform. In non-biodegraded oils the UCM may comprise less than 50% of the total area of the chromatogram, while in biodegraded oils this figure can rise to over 90%. UCMs are also observed in certain refined fractions such as lubricating oils and references therein. In attempting to determine "the processes that regulate the fate of petroleum following release to the environment,” geochemist Christopher M. Reddy of Woods Hole Oceanographic Institution invented an application of comprehensive two-dimensional gas chromatography (GCxGC) that resolves UMPs and that he patented. As it degrades in a marine environment, oil undergoes complex transformations, producing residues composed of extremely complex organic mixtures that accumulate in such “protective environments” as fiddler crabs and marsh grass. These residues form the majority of the unresolved complex mixture (UCM) resulting from the breakdown of crude oils that GC had previously been unable to resolve but which Reddy’s novel GCxGC application has made accessible, enabling determination of “the underlying processes controlling petroleum fate” as it degrades in a marine environment.
Albany ( AL-bə-nee) is a city in and the county seat of Linn County, Oregon, and is the 11th most populous city in the state. Albany is located in the Willamette Valley at the confluence of the Calapooia River and the Willamette River in both Linn and Benton counties, just east of Corvallis and south of Salem. It is predominantly a farming and manufacturing city that settlers founded around 1848. As of the 2020 United States census, the population of Albany, Oregon was 56,472. Albany has a home rule charter, a council–manager government, and a full-time unelected city manager. The city provides the population with access to over 30 parks and trails, a senior center, and many cultural events such as the Northwest Art & Air Festival, River Rhythms, Summer Sounds and Movies at Monteith. In addition to farming and manufacturing, the city's economy depends on retail trade, health care, and social assistance. In recent years the city has worked to revive the downtown shopping area, with help from the Central Albany Revitalization Area.
Sources: en.wikipedia.org
Naturally occurring barium (56Ba) is a mix of six stable isotopes and one very long-lived radioactive primordial isotope, barium-130, identified as being unstable by geochemical means (from analysis of the presence of its daughter xenon-130 in rocks) in 2001, presumably decaying by double electron capture with a half-life of (0.5–2.7)×1021 years (about 1011 times the age of the universe). The two measurements are discordant; the above reflects the total range, the value in the table below is a crude average. With the total range of mass numbers known 114 to 154, there are thirty-three known radioisotopes in addition to 130Ba. The longest-lived of these is 133Ba, which has a half-life of 10.538 years; all others have half-lives shorter than two weeks. The longest-lived isomers are 133mBa at 38.90 hours and 135m1Ba at 28.11 hours. The analogous 137m1Ba (half-life 2.552 minutes) occurs in the decay of the common fission product caesium-137. Barium-114 is theorized to undergo cluster decay, emitting a nucleus of stable 12C to produce 102Sn. This decay has not been observed, with only an upper limit on the branching ratio of such decay (0.0034%).
=== Production area === India is the largest producer of moringa, with an annual production of 1.2 million tonnes of fruit from an area of 380 km2 (150 sq mi). Among Indian states, Tamil Nadu leads in cultivation area followed by Andhra Pradesh and Karnataka. Moringa is grown in home gardens and as living fences in South and Southeast Asia, where it is commonly sold in local markets. In the Philippines and Indonesia, it is commonly grown for its leaves, which are used as food. Moringa is also actively cultivated by the World Vegetable Center in Taiwan, a center for vegetable research. More generally, moringa grows in the wild or is cultivated in Central America and the Caribbean, northern countries of South America, Africa, South and Southeast Asia, and various countries of Oceania. As of 2010, cultivation in Hawaii was in the early stages for commercial distribution in the US.
Banting House features archival materials, artifacts, and other ephemera associated with Banting as co-discoverer of insulin, doctor, and artist, as well as his involvement in the first and second world wars. One gallery depicts the kind of office Banting might have had, and contains several of his belongings, including his original medicine cabinet, and a graduated cylinder Banting used during his time at the University of Western Ontario. The apothecary in the next room features a sink that Banting installed for his medical practice. Other galleries in the museum hold original belongings of Banting as well, most notably his desk and his bed frame. The bed frame is kept in Banting's bedroom, and visitors are encouraged to take a moment or a picture with it, as it is not roped off like many other areas of the museum. Additionally, an official replica of the Nobel Prize medal co-awarded to Banting and Macleod is on display, as well as many of Banting's other medals. Other displays include the military gallery, which includes a representation of the type of operating room Banting would have worked in on the field during the First World War, some information on the projects he headed during the Second World War, and an entire gallery filled with artwork done by Banting.
The 1982 biopic film Frances depicts actress Frances Farmer (the subject of the film) undergoing transorbital lobotomy (though the idea that a lobotomy was performed on Farmer, and that Freeman performed it, has been criticized as having little or no factual foundation). Katherine Dunn's 1989 novel Geek Love centers on a freak show whose leader founds a cult practicing amputation and lobotomy. Joyce Carol Oates's 1995 novel Zombie includes a verbatim extract of Freeman and Watts's 1942 treatise Psychosurgery describing leucotomy. The antihero Quentin reads this passage and similar descriptions of lobotomy. Sexually fantasizing about submissive lobotomized patients, Quentin seeks seeks to replicate Freeman's transorbital lobotomy technique on his victims using an icepick. Jeffrey Dahmer was Oates's inspiration for the character of Quentin; Dahmer did not use Freeman's technique on his victims, but rather drilled into their skulls to pour acid into them.
Sources: en.wikipedia.org
Common methods include spectrophotometric enzyme cycling assays, HPLC with UV or fluorescence detection, and LC-MS/MS. Detection often requires derivatization because glutathione lacks a strong chromophore. Method choice depends on the sample type and the required sensitivity.
Yes, especially in solution or when exposed to oxygen, light, and heat. The reduced form can oxidize to GSSG or form disulfides with other thiols. Powdered material stored cool and dry is generally more stable than aqueous preparations.
Purity refers to the proportion of the intended compound in a sample, often determined by chromatography. A high purity value does not necessarily indicate a specific oxidation state. Buyers may also need information about GSSG content, water, and residual solvents.
Chromatographic methods can separate the two forms before detection. Enzymatic assays often measure total glutathione first and then use a separate procedure to estimate the oxidized fraction. The difference between total and oxidized amounts provides an indirect estimate of the reduced form.